SCOPe 2.08: Domain d2hbka1: 2hbk A:421-516

Lineage for d2hbka1 (2hbk A:421-516)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.60: SAM domain-like [47768] (17 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.8: HRDC-like [47819] (5 families)

5. Family a.60.8.4: EXOSC10 HRDC domain-like [140646] (2 proteins)

6. Protein Exosome complex exonuclease RRP6 domain [140647] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [140648] (4 PDB entries)
   Uniprot Q12149 421-516

8. Domain d2hbka1: 2hbk A:421-516 [136313]
   Other proteins in same PDB: d2hbka2, d2hbka3
   automated match to d2hbja1
   protein/RNA complex; complexed with mn

Details for d2hbka1

PDB Entry: 2hbk, 2.25 Å

PDB Description: structure of the yeast nuclear exosome component, rrp6p, reveals an interplay between the active site and the hrdc domain; protein in complex with mn

PDB Compounds: (A:) Exosome complex exonuclease RRP6

SCOPe Domain Sequences for d2hbka1:

Sequence; same for both SEQRES and ATOM records:

>d2hbka1 a.60.8.4 (A:421-516) Exosome complex exonuclease RRP6 domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kespwkilmyqynipperevlvrelyqwrdliarrddesprfvmpnqllaalvaytptdv
igvvsltngvtehvrqnakllanlirdalrnikntn

Timeline for d2hbka1:

• d2hbka1 first appeared in SCOP 1.73
  
• d2hbka1 appears in SCOPe 2.07