Lineage for d2haxa_ (2hax A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2381452Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2382744Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2383132Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (32 protein domains)
    barrel, closed; n=5, S=8
  6. 2383220Protein Major cold shock protein [50283] (4 species)
  7. 2383221Species Bacillus caldolyticus [TaxId:1394] [50286] (8 PDB entries)
  8. 2383230Domain d2haxa_: 2hax A: [136301]
    automated match to d1c9oa_
    protein/DNA complex; complexed with ca, mpd

Details for d2haxa_

PDB Entry: 2hax (more details), 1.29 Å

PDB Description: crystal structure of bacillus caldolyticus cold shock protein in complex with hexathymidine
PDB Compounds: (A:) Cold shock protein cspB

SCOPe Domain Sequences for d2haxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2haxa_ b.40.4.5 (A:) Major cold shock protein {Bacillus caldolyticus [TaxId: 1394]}
mqrgkvkwfnnekgygfieveggsdvfvhftaiqgegfktleegqevsfeivqgnrgpqa
anvvkl

SCOPe Domain Coordinates for d2haxa_:

Click to download the PDB-style file with coordinates for d2haxa_.
(The format of our PDB-style files is described here.)

Timeline for d2haxa_: