SCOPe 2.08: Domain d2haxa_: 2hax A:

Lineage for d2haxa_ (2hax A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins)
   barrel, closed; n=5, S=8

6. Protein Major cold shock protein [50283] (4 species)

7. Species Bacillus caldolyticus [TaxId:1394] [50286] (8 PDB entries)

8. Domain d2haxa_: 2hax A: [136301]
   automated match to d1c9oa_
   protein/DNA complex; complexed with ca, mpd

Details for d2haxa_

PDB Entry: 2hax, 1.29 Å

PDB Description: crystal structure of bacillus caldolyticus cold shock protein in complex with hexathymidine

PDB Compounds: (A:) Cold shock protein cspB

SCOPe Domain Sequences for d2haxa_:

Sequence; same for both SEQRES and ATOM records:

>d2haxa_ b.40.4.5 (A:) Major cold shock protein {Bacillus caldolyticus [TaxId: 1394]}
mqrgkvkwfnnekgygfieveggsdvfvhftaiqgegfktleegqevsfeivqgnrgpqa
anvvkl

Timeline for d2haxa_:

• d2haxa_ first appeared in SCOP 1.73, called d2haxa1
  
• d2haxa_ appears in SCOPe 2.07