Lineage for d2haxa1 (2hax A:1-66)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 667292Fold b.40: OB-fold [50198] (12 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 668013Superfamily b.40.4: Nucleic acid-binding proteins [50249] (14 families) (S)
  5. 668307Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (22 proteins)
    barrel, closed; n=5, S=8
  6. 668363Protein Major cold shock protein [50283] (4 species)
  7. 668364Species Bacillus caldolyticus [TaxId:1394] [50286] (7 PDB entries)
  8. 668367Domain d2haxa1: 2hax A:1-66 [136301]
    automatically matched to d1c9oa_
    complexed with ca, mpd

Details for d2haxa1

PDB Entry: 2hax (more details), 1.29 Å

PDB Description: crystal structure of bacillus caldolyticus cold shock protein in complex with hexathymidine
PDB Compounds: (A:) Cold shock protein cspB

SCOP Domain Sequences for d2haxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2haxa1 b.40.4.5 (A:1-66) Major cold shock protein {Bacillus caldolyticus [TaxId: 1394]}
mqrgkvkwfnnekgygfieveggsdvfvhftaiqgegfktleegqevsfeivqgnrgpqa
anvvkl

SCOP Domain Coordinates for d2haxa1:

Click to download the PDB-style file with coordinates for d2haxa1.
(The format of our PDB-style files is described here.)

Timeline for d2haxa1: