Lineage for d2h9ha_ (2h9h A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2797303Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)
  6. 2797308Protein 3C cysteine protease (picornain 3C) [50604] (9 species)
  7. 2797341Species Human hepatitis A virus [TaxId:208726] [50606] (5 PDB entries)
  8. 2797343Domain d2h9ha_: 2h9h A: [136264]
    automated match to d1hava_
    complexed with bbl

Details for d2h9ha_

PDB Entry: 2h9h (more details), 1.39 Å

PDB Description: an episulfide cation (thiiranium ring) trapped in the active site of hav 3c proteinase inactivated by peptide-based ketone inhibitors
PDB Compounds: (A:) Hepatitis A virus protease 3C

SCOPe Domain Sequences for d2h9ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h9ha_ b.47.1.4 (A:) 3C cysteine protease (picornain 3C) {Human hepatitis A virus [TaxId: 208726]}
stleiaglvrknlvqfgvgekngsvrwvmnalgvkddwllvpshaykfekdyemmefyfn
rggtyysisagnvviqsldvgfqdvvlmkvptipkfrditqhfikkgdvpralnrlatlv
ttvngtpmlisegplkmeekatyvhkkndgttvdltvdqawrgkgeglpgmcggalvssn
qsiqnailgihvaggnsilvaklvtqemfqni

SCOPe Domain Coordinates for d2h9ha_:

Click to download the PDB-style file with coordinates for d2h9ha_.
(The format of our PDB-style files is described here.)

Timeline for d2h9ha_: