SCOPe 2.07: Domain d2h8fb_: 2h8f B:

Lineage for d2h8fb_ (2h8f B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (26 species)

7. Species Emerald rockcod (Pagothenia bernacchii) [TaxId:40690] [46511] (12 PDB entries)

8. Domain d2h8fb_: 2h8f B: [136240]
   Other proteins in same PDB: d2h8fa_, d2h8fc_
   automated match to d1hbhb_
   complexed with hem

Details for d2h8fb_

PDB Entry: 2h8f, 1.3 Å

PDB Description: Crystal structure of deoxy hemoglobin from Trematomus bernacchii at pH 6.2

PDB Compounds: (B:) Hemoglobin beta subunit

SCOPe Domain Sequences for d2h8fb_:

Sequence; same for both SEQRES and ATOM records:

>d2h8fb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Emerald rockcod (Pagothenia bernacchii) [TaxId: 40690]}
vewtdkersiisdifshmdyddigpkalsrclivypwtqrhfsgfgnlynaeaiignanv
aahgikvlhgldrgvknmdniaatyadlstlhseklhvdpdnfkllsdcitivlaakmgh
aftaetqgafqkflavvvsalgkqyh

Timeline for d2h8fb_:

• d2h8fb_ first appeared in SCOP 1.73, called d2h8fb1
  
• d2h8fb_ appears in SCOPe 2.06
  
• d2h8fb_ appears in the current release, SCOPe 2.08