Lineage for d2h8fb1 (2h8f B:1-146)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 631651Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 631652Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 631691Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 632305Protein Hemoglobin, beta-chain [46500] (22 species)
  7. 632343Species Emerald rockcod (Pagothenia bernacchii) [TaxId:40690] [46511] (6 PDB entries)
  8. 632344Domain d2h8fb1: 2h8f B:1-146 [136240]
    Other proteins in same PDB: d2h8fa1, d2h8fc1
    automatically matched to d1hbhb_
    complexed with ace, hem

Details for d2h8fb1

PDB Entry: 2h8f (more details), 1.3 Å

PDB Description: Crystal structure of deoxy hemoglobin from Trematomus bernacchii at pH 6.2
PDB Compounds: (B:) Hemoglobin beta subunit

SCOP Domain Sequences for d2h8fb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h8fb1 a.1.1.2 (B:1-146) Hemoglobin, beta-chain {Emerald rockcod (Pagothenia bernacchii) [TaxId: 40690]}
vewtdkersiisdifshmdyddigpkalsrclivypwtqrhfsgfgnlynaeaiignanv
aahgikvlhgldrgvknmdniaatyadlstlhseklhvdpdnfkllsdcitivlaakmgh
aftaetqgafqkflavvvsalgkqyh

SCOP Domain Coordinates for d2h8fb1:

Click to download the PDB-style file with coordinates for d2h8fb1.
(The format of our PDB-style files is described here.)

Timeline for d2h8fb1: