![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
![]() | Protein Hemoglobin, beta-chain [46500] (26 species) |
![]() | Species Emerald rockcod (Pagothenia bernacchii) [TaxId:40690] [46511] (12 PDB entries) |
![]() | Domain d2h8dd_: 2h8d D: [136238] Other proteins in same PDB: d2h8da_, d2h8dc_ automated match to d1hbhb_ complexed with hem, k |
PDB Entry: 2h8d (more details), 1.78 Å
SCOPe Domain Sequences for d2h8dd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h8dd_ a.1.1.2 (D:) Hemoglobin, beta-chain {Emerald rockcod (Pagothenia bernacchii) [TaxId: 40690]} vewtdkersiisdifshmdyddigpkalsrclivypwtqrhfsgfgnlynaeaiignanv aahgikvlhgldrgvknmdniaatyadlstlhseklhvdpdnfkllsdcitivlaakmgh aftaetqgafqkflavvvsalgkqyh
Timeline for d2h8dd_: