SCOPe 2.08: Domain d2h6fb1: 2h6f B:521-921

Lineage for d2h6fb1 (2h6f B:521-921)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families)

5. Family a.102.4.3: Protein prenyltransferases [48246] (3 proteins)

6. Protein Protein farnesyltransferase, beta-subunit [48247] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69090] (13 PDB entries)
   Uniprot P49356

8. Domain d2h6fb1: 2h6f B:521-921 [136186]
   Other proteins in same PDB: d2h6fa1
   automatically matched to d1jcqb_
   complexed with acy, far, zn

Details for d2h6fb1

PDB Entry: 2h6f, 1.5 Å

PDB Description: protein farnesyltransferase complexed with a farnesylated ddptasacvls peptide product at 1.5a resolution

PDB Compounds: (B:) Protein farnesyltransferase beta subunit

SCOPe Domain Sequences for d2h6fb1:

Sequence; same for both SEQRES and ATOM records:

>d2h6fb1 a.102.4.3 (B:521-921) Protein farnesyltransferase, beta-subunit {Human (Homo sapiens) [TaxId: 9606]}
eplyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlqrekhfh
ylkrglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcqspeggf
gggpgqyphlaptyaavnalciigteeaydiinrekllqylyslkqpdgsflmhvggevd
vrsaycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfcglaalv
ilkrerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhralhaqgd
palsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaqhfgsga
mlhdvvlgvpenalqpthpvynigpdkviqattyflqkpvp

Timeline for d2h6fb1:

• d2h6fb1 first appeared in SCOP 1.73
  
• d2h6fb1 appears in SCOPe 2.07