Lineage for d2h6fb1 (2h6f B:521-921)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2335133Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2335598Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. 2335726Family a.102.4.3: Protein prenyltransferases [48246] (3 proteins)
  6. 2335727Protein Protein farnesyltransferase, beta-subunit [48247] (2 species)
  7. 2335728Species Human (Homo sapiens) [TaxId:9606] [69090] (13 PDB entries)
    Uniprot P49356
  8. 2335729Domain d2h6fb1: 2h6f B:521-921 [136186]
    Other proteins in same PDB: d2h6fa1
    automatically matched to d1jcqb_
    complexed with acy, far, suc, zn

Details for d2h6fb1

PDB Entry: 2h6f (more details), 1.5 Å

PDB Description: protein farnesyltransferase complexed with a farnesylated ddptasacvls peptide product at 1.5a resolution
PDB Compounds: (B:) Protein farnesyltransferase beta subunit

SCOPe Domain Sequences for d2h6fb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h6fb1 a.102.4.3 (B:521-921) Protein farnesyltransferase, beta-subunit {Human (Homo sapiens) [TaxId: 9606]}
eplyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlqrekhfh
ylkrglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcqspeggf
gggpgqyphlaptyaavnalciigteeaydiinrekllqylyslkqpdgsflmhvggevd
vrsaycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfcglaalv
ilkrerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhralhaqgd
palsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaqhfgsga
mlhdvvlgvpenalqpthpvynigpdkviqattyflqkpvp

SCOPe Domain Coordinates for d2h6fb1:

Click to download the PDB-style file with coordinates for d2h6fb1.
(The format of our PDB-style files is described here.)

Timeline for d2h6fb1: