Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) |
Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins) |
Protein Hypothetical protein Them2 [143179] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [143181] (2 PDB entries) Uniprot Q9NPJ3 19-139! Uniprot Q9NPJ3 3-138 |
Domain d2h4ua1: 2h4u A:19-139 [136082] Other proteins in same PDB: d2h4ud3 |
PDB Entry: 2h4u (more details), 2.2 Å
SCOPe Domain Sequences for d2h4ua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h4ua1 d.38.1.5 (A:19-139) Hypothetical protein Them2 {Human (Homo sapiens) [TaxId: 9606]} rnfervlgkitlvsaapgkvicemkveeehtnaigtlhggltatlvdnistmallcterg apgvsvdmnitymspaklgedivitahvlkqgktlaftsvdltnkatgkliaqgrhtkhl g
Timeline for d2h4ua1:
View in 3D Domains from other chains: (mouse over for more information) d2h4ub_, d2h4uc_, d2h4ud2, d2h4ud3 |