![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
![]() | Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) ![]() |
![]() | Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins) |
![]() | Protein Hypothetical protein Them2 [143179] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [143181] (2 PDB entries) Uniprot Q9NPJ3 19-139! Uniprot Q9NPJ3 3-138 |
![]() | Domain d2h4ub_: 2h4u B: [136083] Other proteins in same PDB: d2h4ud3 automated match to d2h4ua1 |
PDB Entry: 2h4u (more details), 2.2 Å
SCOPe Domain Sequences for d2h4ub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h4ub_ d.38.1.5 (B:) Hypothetical protein Them2 {Human (Homo sapiens) [TaxId: 9606]} rnfervlgkitlvsaapgkvicemkveeehtnaigtlhggltatlvdnistmallcterg apgvsvdmnitymspaklgedivitahvlkqgktlaftsvdltnkatgkliaqgrhtkhl g
Timeline for d2h4ub_:
![]() Domains from other chains: (mouse over for more information) d2h4ua1, d2h4uc_, d2h4ud2, d2h4ud3 |