SCOP 1.75: Domain d2h4lx4: 2h4l X:368-463

Lineage for d2h4lx4 (2h4l X:368-463)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.2: Phosphoglucomutase, C-terminal domain [55957] (1 family)
   contains a single copy of this fold and an extra beta-strand at the C-terminus

5. Family d.129.2.1: Phosphoglucomutase, C-terminal domain [55958] (4 proteins)
   Pfam PF00408

6. Protein Phosphomannomutase/phosphoglucomutase [81375] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [81374] (12 PDB entries)

8. Domain d2h4lx4: 2h4l X:368-463 [136081]
   Other proteins in same PDB: d2h4lx1, d2h4lx2, d2h4lx3
   automatically matched to d1k2yx4
   complexed with r1p, zn

Details for d2h4lx4

PDB Entry: 2h4l, 2.4 Å

PDB Description: complex of pmm/pgm with ribose 1-phosphate

PDB Compounds: (X:) Phosphomannomutase/phosphoglucomutase

SCOP Domain Sequences for d2h4lx4:

Sequence; same for both SEQRES and ATOM records:

>d2h4lx4 d.129.2.1 (X:368-463) Phosphomannomutase/phosphoglucomutase {Pseudomonas aeruginosa [TaxId: 287]}
psdistpeinitvtedskfaiiealqrdaqwgegnittldgvrvdypkgwglvrasnttp
vlvlrfeadteeeleriktvfrnqlkavdsslpvpf

Timeline for d2h4lx4:

• d2h4lx4 first appeared in SCOP 1.73
  
• d2h4lx4 appears in SCOPe 2.01
  
• d2h4lx4 appears in the current release, SCOPe 2.08