Lineage for d2h4lx4 (2h4l X:368-463)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2975208Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2975429Superfamily d.129.2: Phosphoglucomutase, C-terminal domain [55957] (2 families) (S)
    contains a single copy of this fold and an extra beta-strand at the C-terminus
  5. 2975430Family d.129.2.1: Phosphoglucomutase, C-terminal domain [55958] (4 proteins)
    Pfam PF00408
  6. 2975454Protein Phosphomannomutase/phosphoglucomutase [81375] (1 species)
  7. 2975455Species Pseudomonas aeruginosa [TaxId:287] [81374] (12 PDB entries)
  8. 2975467Domain d2h4lx4: 2h4l X:368-463 [136081]
    Other proteins in same PDB: d2h4lx1, d2h4lx2, d2h4lx3
    automated match to d1p5dx4
    complexed with r1p, zn

Details for d2h4lx4

PDB Entry: 2h4l (more details), 2.4 Å

PDB Description: complex of pmm/pgm with ribose 1-phosphate
PDB Compounds: (X:) Phosphomannomutase/phosphoglucomutase

SCOPe Domain Sequences for d2h4lx4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h4lx4 d.129.2.1 (X:368-463) Phosphomannomutase/phosphoglucomutase {Pseudomonas aeruginosa [TaxId: 287]}
psdistpeinitvtedskfaiiealqrdaqwgegnittldgvrvdypkgwglvrasnttp
vlvlrfeadteeeleriktvfrnqlkavdsslpvpf

SCOPe Domain Coordinates for d2h4lx4:

Click to download the PDB-style file with coordinates for d2h4lx4.
(The format of our PDB-style files is described here.)

Timeline for d2h4lx4: