PDB entry 2h4l

View 2h4l on RCSB PDB site
Description: Complex of PMM/PGM with ribose 1-phosphate
Class: isomerase
Keywords: protein-ligand complex, slow substrate, ribose 1-phosphate
Deposited on 2006-05-24, released 2006-08-08
The last revision prior to the SCOP 1.75 freeze date was dated 2006-08-08, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.19
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Phosphomannomutase/phosphoglucomutase
    Species: Pseudomonas aeruginosa
    Gene: AlgC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26276 (Start-462)
      • modified residue (107)
    Domains in SCOP 1.75: d2h4lx1, d2h4lx2, d2h4lx3, d2h4lx4
  • Heterogens: R1P, ZN, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >2h4lX (X:)
    mstvkaptlpasifraydirgvvgdtltaetaywigraigseslargepcvavgrdgrls
    gpelvkqliqglvdcgcqvsdvgmvptpvlyyaanvlegksgvmltgshnppdyngfkiv
    vagetlaneqiqalreriekndlasgvgsveqvdilpryfkqirddiamakpmkvvvdcg
    ngvagviapqliealgcsviplycevdgnfpnhhpdpgkpenlkdliakvkaenadlgla
    fdgdgdrvgvvtntgtiiypdrllmlfakdvvsrnpgadiifdvkctrrlialisgyggr
    pvmwktghslikkkmketgallagemsghvffkerwfgfddgiysaarlleilsqdqrds
    ehvfsafpsdistpeinitvtedskfaiiealqrdaqwgegnittldgvrvdypkgwglv
    rasnttpvlvlrfeadteeeleriktvfrnqlkavdsslpvpf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h4lX (X:)
    lpasifraydirgvvgdtltaetaywigraigseslargepcvavgrdgrlsgpelvkql
    iqglvdcgcqvsdvgmvptpvlyyaanvlegksgvmltgshnppdyngfkivvagetlan
    eqiqalreriekndlasgvgsveqvdilpryfkqirddiamakpmkvvvdcgngvagvia
    pqliealgcsviplycevdgnfpnhhpdpgkpenlkdliakvkaenadlglafdgdgdrv
    gvvtntgtiiypdrllmlfakdvvsrnpgadiifdvkctrrlialisgyggrpvmwktgh
    slikkkmketgallagemsghvffkerwfgfddgiysaarlleilsqdqrdsehvfsafp
    sdistpeinitvtedskfaiiealqrdaqwgegnittldgvrvdypkgwglvrasnttpv
    lvlrfeadteeeleriktvfrnqlkavdsslpvpf