SCOPe 2.08: Domain d2h44a_: 2h44 A:

Lineage for d2h44a_ (2h44 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families)

5. Family a.211.1.2: PDEase [48548] (7 proteins)
   Pfam PF00233; multihelical; can be divided into three subdomains

6. Protein cGMP-specific 3',5'-cyclic phosphodiesterase pde5a1-Ibmx [101439] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101440] (26 PDB entries)
   Uniprot O76074 534-860

8. Domain d2h44a_: 2h44 A: [136069]
   automated match to d1rkpa_
   complexed with 7ca, mg, zn

Details for d2h44a_

PDB Entry: 2h44, 1.8 Å

PDB Description: Crystal structure of PDE5A1 in complex with icarisid II

PDB Compounds: (A:) cGMP-specific 3',5'-cyclic phosphodiesterase

SCOPe Domain Sequences for d2h44a_:

Sequence; same for both SEQRES and ATOM records:

>d2h44a_ a.211.1.2 (A:) cGMP-specific 3',5'-cyclic phosphodiesterase pde5a1-Ibmx {Human (Homo sapiens) [TaxId: 9606]}
eetrelqslaaavvpsaqtlkitdfsfsdfelsdletalctirmftdlnlvqnfqmkhev
lcrwilsvkknyrknvayhnwrhafntaqcmfaalkagkiqnkltdleilalliaalshd
ldhrgvnnsyiqrsehplaqlychsimehhhfdqclmilnspgnqilsglsieeykttlk
iikqailatdlalyikrrgeffelirknqfnledphqkelflamlmtacdlsaitkpwpi
qqriaelvateffdqgdrerkelnieptdlmnrekknkipsmqvgfidaiclqlyealth
vsedcfplldgcrknrqkwqalaeqq

Timeline for d2h44a_:

• d2h44a_ first appeared in SCOP 1.73, called d2h44a1
  
• d2h44a_ appears in SCOPe 2.07