SCOP 1.73: Domain d2h44a1: 2h44 A:535-860

Lineage for d2h44a1 (2h44 A:535-860)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (5 families)

5. Family a.211.1.2: PDEase [48548] (6 proteins)
   Pfam PF00233; multihelical; can be divided into three subdomains

6. Protein cGMP-specific 3',5'-cyclic phosphodiesterase pde5a1-Ibmx [101439] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101440] (13 PDB entries)

8. Domain d2h44a1: 2h44 A:535-860 [136069]
   automatically matched to d1t9ra_
   complexed with 7ca, mg, zn

Details for d2h44a1

PDB Entry: 2h44, 1.8 Å

PDB Description: Crystal structure of PDE5A1 in complex with icarisid II

PDB Compounds: (A:) cGMP-specific 3',5'-cyclic phosphodiesterase

SCOP Domain Sequences for d2h44a1:

Sequence; same for both SEQRES and ATOM records:

>d2h44a1 a.211.1.2 (A:535-860) cGMP-specific 3',5'-cyclic phosphodiesterase pde5a1-Ibmx {Human (Homo sapiens) [TaxId: 9606]}
eetrelqslaaavvpsaqtlkitdfsfsdfelsdletalctirmftdlnlvqnfqmkhev
lcrwilsvkknyrknvayhnwrhafntaqcmfaalkagkiqnkltdleilalliaalshd
ldhrgvnnsyiqrsehplaqlychsimehhhfdqclmilnspgnqilsglsieeykttlk
iikqailatdlalyikrrgeffelirknqfnledphqkelflamlmtacdlsaitkpwpi
qqriaelvateffdqgdrerkelnieptdlmnrekknkipsmqvgfidaiclqlyealth
vsedcfplldgcrknrqkwqalaeqq

Timeline for d2h44a1:

• d2h44a1 is new in SCOP 1.73
  
• d2h44a1 appears in SCOP 1.75
  
• d2h44a1 appears in the current release, SCOPe 2.08, called d2h44a_