SCOPe 2.02: Domain d2h25a1: 2h25 A:1-370

Lineage for d2h25a1 (2h25 A:1-370)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins)

6. Protein D-maltodextrin-binding protein, MBP [53862] (5 species)
   contains a few additional helices in the C-terminal extension; homologous to thiaminase I

7. Species Escherichia coli [TaxId:562] [53863] (47 PDB entries)
   Uniprot P02928

8. Domain d2h25a1: 2h25 A:1-370 [135989]
   automatically matched to d1mpb__

Details for d2h25a1

PDB Entry: 2h25

PDB Description: solution structure of maltose binding protein complexed with beta- cyclodextrin

PDB Compounds: (A:) Maltose-binding periplasmic protein

SCOPe Domain Sequences for d2h25a1:

Sequence; same for both SEQRES and ATOM records:

>d2h25a1 c.94.1.1 (A:1-370) D-maltodextrin-binding protein, MBP {Escherichia coli [TaxId: 562]}
kteegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd
vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv
nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdea
lkdaqtritk

Timeline for d2h25a1:

• d2h25a1 first appeared in SCOP 1.73
  
• d2h25a1 appears in SCOPe 2.01
  
• d2h25a1 appears in SCOPe 2.03
  
• d2h25a1 appears in the current release, SCOPe 2.08, called d2h25a_