Lineage for d2h0gb2 (2h0g B:2-61)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2936239Superfamily d.17.3: DsbC/DsbG N-terminal domain-like [54423] (2 families) (S)
  5. 2936240Family d.17.3.1: DsbC/DsbG N-terminal domain-like [54424] (3 proteins)
  6. 2936256Protein Thiol:disulfide interchange protein DsbG, N-terminal domain [110822] (1 species)
  7. 2936257Species Escherichia coli [TaxId:562] [110823] (5 PDB entries)
    Uniprot P77202
  8. 2936267Domain d2h0gb2: 2h0g B:2-61 [135932]
    Other proteins in same PDB: d2h0ga1, d2h0gb1
    automated match to d1v58a2
    complexed with so4; mutant

Details for d2h0gb2

PDB Entry: 2h0g (more details), 2.3 Å

PDB Description: crystal structure of dsbg t200m mutant
PDB Compounds: (B:) Thiol:disulfide interchange protein dsbG

SCOPe Domain Sequences for d2h0gb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h0gb2 d.17.3.1 (B:2-61) Thiol:disulfide interchange protein DsbG, N-terminal domain {Escherichia coli [TaxId: 562]}
elpapvkaiekqgitiiktfdapggmkgylgkyqdmgvtiyltpdgkhaisgymynekge

SCOPe Domain Coordinates for d2h0gb2:

Click to download the PDB-style file with coordinates for d2h0gb2.
(The format of our PDB-style files is described here.)

Timeline for d2h0gb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2h0gb1