Lineage for d2h0ga1 (2h0g A:62-230)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2877401Family c.47.1.9: DsbC/DsbG C-terminal domain-like [52898] (3 proteins)
    elaborated common fold
  6. 2877415Protein Thiol:disulfide interchange protein DsbG, C-terminal domain [110610] (1 species)
  7. 2877416Species Escherichia coli [TaxId:562] [110611] (5 PDB entries)
    Uniprot P77202
  8. 2877425Domain d2h0ga1: 2h0g A:62-230 [135929]
    Other proteins in same PDB: d2h0ga2, d2h0gb2
    automated match to d1v58a1
    complexed with so4; mutant

Details for d2h0ga1

PDB Entry: 2h0g (more details), 2.3 Å

PDB Description: crystal structure of dsbg t200m mutant
PDB Compounds: (A:) Thiol:disulfide interchange protein dsbG

SCOPe Domain Sequences for d2h0ga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h0ga1 c.47.1.9 (A:62-230) Thiol:disulfide interchange protein DsbG, C-terminal domain {Escherichia coli [TaxId: 562]}
nlsntliekeiyapagremwqrmeqshwlldgkkdapvivyvfadpfcpyckqfwqqarp
wvdsgkvqlrtllvgvikpespataaailaskdpaktwqqyeasggklklnvpanvsteq
mkvlsdneklmddlganvmpaiyymskentlqqavglpdqktlniimgn

SCOPe Domain Coordinates for d2h0ga1:

Click to download the PDB-style file with coordinates for d2h0ga1.
(The format of our PDB-style files is described here.)

Timeline for d2h0ga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2h0ga2