| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.9: DsbC/DsbG C-terminal domain-like [52898] (3 proteins) elaborated common fold |
| Protein Thiol:disulfide interchange protein DsbG, C-terminal domain [110610] (1 species) |
| Species Escherichia coli [TaxId:562] [110611] (5 PDB entries) Uniprot P77202 |
| Domain d2h0ga1: 2h0g A:62-230 [135929] Other proteins in same PDB: d2h0ga2, d2h0gb2 automated match to d1v58a1 complexed with so4; mutant |
PDB Entry: 2h0g (more details), 2.3 Å
SCOPe Domain Sequences for d2h0ga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h0ga1 c.47.1.9 (A:62-230) Thiol:disulfide interchange protein DsbG, C-terminal domain {Escherichia coli [TaxId: 562]}
nlsntliekeiyapagremwqrmeqshwlldgkkdapvivyvfadpfcpyckqfwqqarp
wvdsgkvqlrtllvgvikpespataaailaskdpaktwqqyeasggklklnvpanvsteq
mkvlsdneklmddlganvmpaiyymskentlqqavglpdqktlniimgn
Timeline for d2h0ga1: