SCOPe 2.08: Domain d2h0ga2: 2h0g A:2-61

Lineage for d2h0ga2 (2h0g A:2-61)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.3: DsbC/DsbG N-terminal domain-like [54423] (2 families)

5. Family d.17.3.1: DsbC/DsbG N-terminal domain-like [54424] (3 proteins)

6. Protein Thiol:disulfide interchange protein DsbG, N-terminal domain [110822] (1 species)

7. Species Escherichia coli [TaxId:562] [110823] (5 PDB entries)
   Uniprot P77202

8. Domain d2h0ga2: 2h0g A:2-61 [135930]
   Other proteins in same PDB: d2h0ga1, d2h0gb1
   automated match to d1v58a2
   complexed with so4; mutant

Details for d2h0ga2

PDB Entry: 2h0g, 2.3 Å

PDB Description: crystal structure of dsbg t200m mutant

PDB Compounds: (A:) Thiol:disulfide interchange protein dsbG

SCOPe Domain Sequences for d2h0ga2:

Sequence; same for both SEQRES and ATOM records:

>d2h0ga2 d.17.3.1 (A:2-61) Thiol:disulfide interchange protein DsbG, N-terminal domain {Escherichia coli [TaxId: 562]}
elpapvkaiekqgitiiktfdapggmkgylgkyqdmgvtiyltpdgkhaisgymynekge

Timeline for d2h0ga2:

• d2h0ga2 first appeared in SCOP 1.73
  
• d2h0ga2 appears in SCOPe 2.07