Lineage for d2gyqb_ (2gyq B:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1484437Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1484438Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1486262Family a.25.1.4: YciF-like [140445] (3 proteins)
    Pfam PF05974; DUF892
  6. 1486267Protein Hypothetical ptotein RPA3308 [140446] (1 species)
    putative structural protein
  7. 1486268Species Rhodopseudomonas palustris [TaxId:1076] [140447] (1 PDB entry)
    Uniprot Q6N4M9 1-160
  8. 1486270Domain d2gyqb_: 2gyq B: [135864]
    automated match to d2gyqa1
    complexed with act, edo, fe, na, zn

Details for d2gyqb_

PDB Entry: 2gyq (more details), 1.4 Å

PDB Description: YcfI, a putative structural protein from Rhodopseudomonas palustris.
PDB Compounds: (B:) ycfI, putative structural protein

SCOPe Domain Sequences for d2gyqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gyqb_ a.25.1.4 (B:) Hypothetical ptotein RPA3308 {Rhodopseudomonas palustris [TaxId: 1076]}
ffsrdiqtmedlllhglrdiyyaeqqitkalpkmieqatnrdlsqgltshleetqkqier
ldqvfkklgqkpsgvncpaidglikeadetageiadktvldaaivanaqavehyeiaryg
tliawaeelghddivrflttnlneekaantklntval

SCOPe Domain Coordinates for d2gyqb_:

Click to download the PDB-style file with coordinates for d2gyqb_.
(The format of our PDB-style files is described here.)

Timeline for d2gyqb_: