SCOP 1.73: Domain d2gwsi2: 2gws I:329-385

Lineage for d2gwsi2 (2gws I:329-385)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.60: SAM domain-like [47768] (15 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.12: DNA polymerase beta-like, second domain [81585] (1 family)
   contains one classic and one pseudo HhH motifs

5. Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins)
   topological similarity to the N-terminal domain

6. Protein DNA polymerase lambda [101253] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101254] (14 PDB entries)

8. Domain d2gwsi2: 2gws I:329-385 [135820]
   Other proteins in same PDB: d2gwsa1, d2gwsa3, d2gwse1, d2gwse3, d2gwsi1, d2gwsi3, d2gwsm1, d2gwsm3
   automatically matched to d1rzta2
   complexed with cac, cl, edo, mg, na

Details for d2gwsi2

PDB Entry: 2gws, 2.4 Å

PDB Description: crystal structure of human dna polymerase lambda with a g/g mismatch in the primer terminus

PDB Compounds: (I:) DNA polymerase lambda

SCOP Domain Sequences for d2gwsi2:

Sequence; same for both SEQRES and ATOM records:

>d2gwsi2 a.60.12.1 (I:329-385) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]}
sesvpvlelfsniwgagtktaqmwyqqgfrsledirsqaslttqqaiglkhysdfle

Timeline for d2gwsi2:

• d2gwsi2 is new in SCOP 1.73
  
• d2gwsi2 appears in SCOP 1.75
  
• d2gwsi2 appears in the current release, SCOPe 2.08