![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.60: SAM domain-like [47768] (15 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.12: DNA polymerase beta-like, second domain [81585] (1 family) ![]() contains one classic and one pseudo HhH motifs |
![]() | Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins) topological similarity to the N-terminal domain |
![]() | Protein DNA polymerase lambda [101253] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [101254] (14 PDB entries) |
![]() | Domain d1rzta2: 1rzt A:329-385 [98225] Other proteins in same PDB: d1rzta1, d1rzta3, d1rzte1, d1rzte3, d1rzti1, d1rzti3, d1rztm1, d1rztm3 |
PDB Entry: 1rzt (more details), 2.1 Å
SCOP Domain Sequences for d1rzta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rzta2 a.60.12.1 (A:329-385) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]} sesvpvlelfsniwgagtktaqmwyqqgfrsledirsqaslttqqaiglkhysdfle
Timeline for d1rzta2: