Lineage for d2gwsi2 (2gws I:329-385)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2716398Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 2716399Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins)
    topological similarity to the N-terminal domain
    automatically mapped to Pfam PF10391
  6. 2716577Protein DNA polymerase lambda [101253] (1 species)
  7. 2716578Species Human (Homo sapiens) [TaxId:9606] [101254] (27 PDB entries)
  8. 2716621Domain d2gwsi2: 2gws I:329-385 [135820]
    Other proteins in same PDB: d2gwsa1, d2gwsa3, d2gwse1, d2gwse3, d2gwsi1, d2gwsi3, d2gwsm1, d2gwsm3
    automated match to d2pfna2
    protein/DNA complex; complexed with cac, cl, edo, mg, na

Details for d2gwsi2

PDB Entry: 2gws (more details), 2.4 Å

PDB Description: crystal structure of human dna polymerase lambda with a g/g mismatch in the primer terminus
PDB Compounds: (I:) DNA polymerase lambda

SCOPe Domain Sequences for d2gwsi2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gwsi2 a.60.12.1 (I:329-385) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]}
sesvpvlelfsniwgagtktaqmwyqqgfrsledirsqaslttqqaiglkhysdfle

SCOPe Domain Coordinates for d2gwsi2:

Click to download the PDB-style file with coordinates for d2gwsi2.
(The format of our PDB-style files is described here.)

Timeline for d2gwsi2: