Lineage for d2gwkb2 (2gwk B:147-374)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1171250Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1171251Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) (S)
    duplication contains two domains of this fold
  5. 1171252Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)
  6. 1171253Protein Actin [53073] (6 species)
  7. 1171284Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (41 PDB entries)
    Uniprot P02568 ! SQ 02568
  8. 1171322Domain d2gwkb2: 2gwk B:147-374 [135812]
    automatically matched to d1hlua2
    complexed with atp, ca

Details for d2gwkb2

PDB Entry: 2gwk (more details), 2 Å

PDB Description: SpvB ADP-ribosylated actin: orthorhombic crystal form
PDB Compounds: (B:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d2gwkb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gwkb2 c.55.1.1 (B:147-374) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
rttgivldsgdgvthnvpiyegyalphaimrldlagrdltdylmkiltergysfvttaer
eivrdikeklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqpsf
igmesagihettynsimkcdidirkdlyannvmsggttmypgiadrmqkeitalapstmk
ikiiapperkysvwiggsilaslstfqqmwitkqeydeagpsivhrkc

SCOPe Domain Coordinates for d2gwkb2:

Click to download the PDB-style file with coordinates for d2gwkb2.
(The format of our PDB-style files is described here.)

Timeline for d2gwkb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gwkb1