SCOPe 2.08: Domain d2gwkb2: 2gwk B:148-375

Lineage for d2gwkb2 (2gwk B:148-375)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein automated matches [226905] (13 species)
   not a true protein

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225126] (15 PDB entries)

8. Domain d2gwkb2: 2gwk B:148-375 [135812]
   Other proteins in same PDB: d2gwka1, d2gwkb1
   automated match to d1lcua2
   complexed with atp, ca

Details for d2gwkb2

PDB Entry: 2gwk, 2 Å

PDB Description: SpvB ADP-ribosylated actin: orthorhombic crystal form

PDB Compounds: (B:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d2gwkb2:

Sequence; same for both SEQRES and ATOM records:

>d2gwkb2 c.55.1.1 (B:148-375) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ttgivldsgdgvthnvpiyegyalphaimrldlagrdltdylmkiltergysfvttaere
ivrdikeklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqpsfi
gmesagihettynsimkcdidirkdlyannvmsggttmypgiadrmqkeitalapstmki
kiiapperkysvwiggsilaslstfqqmwitkqeydeagpsivhrkcf

Timeline for d2gwkb2:

• d2gwkb2 first appeared in SCOP 1.73
  
• d2gwkb2 appears in SCOPe 2.07