Lineage for d2gvzc1 (2gvz C:88-201)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2002645Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)
    5 helices; folded leaf
  4. 2002646Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family) (S)
    this domain interrupts the G-protein common fold
  5. 2002647Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)
  6. 2002648Protein Transducin (alpha subunit), insertion domain [47897] (4 species)
  7. 2002649Species Cow (Bos taurus) [TaxId:9913] [47898] (18 PDB entries)
  8. 2002672Domain d2gvzc1: 2gvz C:88-201 [135799]
    Other proteins in same PDB: d2gvza1, d2gvzb1, d2gvzc2
    automatically matched to d1azsc1
    complexed with cl, fkp, gsp, mn, ona

Details for d2gvzc1

PDB Entry: 2gvz (more details), 3.27 Å

PDB Description: crystal structure of complex of gs- with the catalytic domains of mammalian adenylyl cyclase: complex with mant-atp and mn
PDB Compounds: (C:) Guanine nucleotide-binding protein G(s), alpha subunit

SCOPe Domain Sequences for d2gvzc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gvzc1 a.66.1.1 (C:88-201) Transducin (alpha subunit), insertion domain {Cow (Bos taurus) [TaxId: 9913]}
katkvqdiknnlkeaietivaamsnlvppvelanpenqfrvdyilsvmnvpdfdfppefy
ehakalwedegvracyersneyqlidcaqyfldkidvikqddyvpsdqdllrcr

SCOPe Domain Coordinates for d2gvzc1:

Click to download the PDB-style file with coordinates for d2gvzc1.
(The format of our PDB-style files is described here.)

Timeline for d2gvzc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gvzc2