![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily) 5 helices; folded leaf |
![]() | Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family) ![]() this domain interrupts the G-protein common fold |
![]() | Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein) |
![]() | Protein Transducin (alpha subunit), insertion domain [47897] (4 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [47898] (18 PDB entries) |
![]() | Domain d2gvzc1: 2gvz C:88-201 [135799] Other proteins in same PDB: d2gvza1, d2gvzb1, d2gvzc2 automatically matched to d1azsc1 complexed with cl, fkp, gsp, mn, ona |
PDB Entry: 2gvz (more details), 3.27 Å
SCOPe Domain Sequences for d2gvzc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gvzc1 a.66.1.1 (C:88-201) Transducin (alpha subunit), insertion domain {Cow (Bos taurus) [TaxId: 9913]} katkvqdiknnlkeaietivaamsnlvppvelanpenqfrvdyilsvmnvpdfdfppefy ehakalwedegvracyersneyqlidcaqyfldkidvikqddyvpsdqdllrcr
Timeline for d2gvzc1: