![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.77: beta-Prism I [51091] (3 superfamilies) consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis duplication: has internal pseudo threefold symmetry |
![]() | Superfamily b.77.3: Mannose-binding lectins [51101] (2 families) ![]() |
![]() | Family b.77.3.1: Mannose-binding lectins [51102] (7 proteins) |
![]() | Protein Griffithsin [141569] (2 species) single-chain subunits form a segment-swapped dimer |
![]() | Species Red alga (Griffithsia) [TaxId:35158] [141570] (7 PDB entries) Uniprot P84801 1-121 |
![]() | Domain d2guca1: 2guc A:1-121 [135730] automatically matched to 2GTY A:1-121 complexed with edo, man, so4 |
PDB Entry: 2guc (more details), 1.79 Å
SCOPe Domain Sequences for d2guca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2guca1 b.77.3.1 (A:1-121) Griffithsin {Red alga (Griffithsia) [TaxId: 35158]} slthrkfggsggspfsglssiavrsgsyldaiiidgvhhggsggnlsptftfgsgeyisn mtirsgdyidnisfetnmgrrfgpyggsggsantlsnvkviqingsagdyldsldiyyeq y
Timeline for d2guca1: