Lineage for d2guca1 (2guc A:1-121)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 676676Fold b.77: beta-Prism I [51091] (3 superfamilies)
    consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
    duplication: has internal pseudo threefold symmetry
  4. 676694Superfamily b.77.3: Mannose-binding lectins [51101] (1 family) (S)
  5. 676695Family b.77.3.1: Mannose-binding lectins [51102] (6 proteins)
  6. 676730Protein Griffithsin [141569] (1 species)
    single-chain subunits form a segment-swapped dimer
  7. 676731Species Red alga (Griffithsia) [TaxId:35158] [141570] (7 PDB entries)
  8. 676738Domain d2guca1: 2guc A:1-121 [135730]
    automatically matched to 2GTY A:1-121
    complexed with ace, edo, man, so4

Details for d2guca1

PDB Entry: 2guc (more details), 1.79 Å

PDB Description: crystal structure of a complex of griffithsin with mannose at 1.78 a resolution.
PDB Compounds: (A:) Griffithsin

SCOP Domain Sequences for d2guca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2guca1 b.77.3.1 (A:1-121) Griffithsin {Red alga (Griffithsia) [TaxId: 35158]}
slthrkfggsggspfsglssiavrsgsyldaiiidgvhhggsggnlsptftfgsgeyisn
mtirsgdyidnisfetnmgrrfgpyggsggsantlsnvkviqingsagdyldsldiyyeq
y

SCOP Domain Coordinates for d2guca1:

Click to download the PDB-style file with coordinates for d2guca1.
(The format of our PDB-style files is described here.)

Timeline for d2guca1: