SCOPe 2.08: Domain d2greh1: 2gre H:74-186

Lineage for d2greh1 (2gre H:74-186)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies)
   barrel, closed; n=6, S=8; greek-key
   Many cradle-loop superfamilies may be homologous, according to PubMed 18457946

4. Superfamily b.49.3: Aminopeptidase/glucanase lid domain [101821] (1 family)

5. Family b.49.3.1: Aminopeptidase/glucanase lid domain [101822] (7 proteins)

6. Protein Deblocking aminopeptidase YhfE [141387] (1 species)

7. Species Bacillus cereus [TaxId:1396] [141388] (1 PDB entry)
   Uniprot Q81HB5 74-186
   BC0901

8. Domain d2greh1: 2gre H:74-186 [135542]
   Other proteins in same PDB: d2grea2, d2greb2, d2grec2, d2gred2, d2gree2, d2gref2, d2greg2, d2greh2, d2grei2, d2grej2, d2grek2, d2grel2, d2grem2, d2gren2, d2greo2, d2grep2
   automated match to d2grea1
   complexed with so4

Details for d2greh1

PDB Entry: 2gre, 2.65 Å

PDB Description: Crystal structure of Deblocking aminopeptidase from Bacillus cereus

PDB Compounds: (H:) Deblocking aminopeptidase

SCOPe Domain Sequences for d2greh1:

Sequence, based on SEQRES records:

>d2greh1 b.49.3.1 (H:74-186) Deblocking aminopeptidase YhfE {Bacillus cereus [TaxId: 1396]}
gamvkeikpdgrlslsmiggfrwnsvegeyceietssgktytgtilmhqtsvhvykdage
akrdeknievridervfsadevrelgievgdfvsfdprvqitesgyiksrhld

Sequence, based on observed residues (ATOM records):

>d2greh1 b.49.3.1 (H:74-186) Deblocking aminopeptidase YhfE {Bacillus cereus [TaxId: 1396]}
gamvkeikpdgrlslsmiggfrwnsvegeyceietssgktytgtilmnievridervfsa
devrelgievgdfvsfdprvqitesgyiksrhld

Timeline for d2greh1:

• d2greh1 first appeared in SCOP 1.73
  
• d2greh1 appears in SCOPe 2.07