SCOPe 2.08: Domain d2grep2: 2gre P:3-73,P:187-348

Lineage for d2grep2 (2gre P:3-73,P:187-348)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families)
   core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest

5. Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (18 proteins)

6. Protein Deblocking aminopeptidase YhfE [142512] (1 species)
   contains insert beta-barrel domain

7. Species Bacillus cereus [TaxId:1396] [142513] (1 PDB entry)
   Uniprot Q81HB5 3-73,187-348
   BC0901

8. Domain d2grep2: 2gre P:3-73,P:187-348 [135559]
   Other proteins in same PDB: d2grea1, d2greb1, d2grec1, d2gred1, d2gree1, d2gref1, d2greg1, d2greh1, d2grei1, d2grej1, d2grek1, d2grel1, d2grem1, d2gren1, d2greo1, d2grep1
   automated match to d2grea2
   complexed with so4

Details for d2grep2

PDB Entry: 2gre, 2.65 Å

PDB Description: Crystal structure of Deblocking aminopeptidase from Bacillus cereus

PDB Compounds: (P:) Deblocking aminopeptidase

SCOPe Domain Sequences for d2grep2:

Sequence, based on SEQRES records:

>d2grep2 c.56.5.4 (P:3-73,P:187-348) Deblocking aminopeptidase YhfE {Bacillus cereus [TaxId: 1396]}
hhtketmelikelvsipspsgntakiinfienyvsewnvetkrnnkgaliltvkgkndaq
hrlltahvdtlXdkvsvaillklikrlqdenvtlpytthflisnneeigyggnsnipeet
veylavdmgalgdgqasdeytvsicakdssgpyhyalrkhlvelaktnhieykvdiypyy
gsdasaairagfdvkhaligagidsshaferthessiahtealvyayvmsnlie

Sequence, based on observed residues (ATOM records):

>d2grep2 c.56.5.4 (P:3-73,P:187-348) Deblocking aminopeptidase YhfE {Bacillus cereus [TaxId: 1396]}
hhtketmelikelvsipspsgntakiinfienyvsewnvetkrnnkgaliltvkgkndaq
hrlltahvdtlXdkvsvaillklikrlqdenvtlpytthflisnnenipeetveylavdm
galgdgdeytvsicakdssgpyhyalrkhlvelaktnhieykvdiypyyragfdvkhali
gagidssferthessiahtealvyayvmsnlie

Timeline for d2grep2:

• d2grep2 first appeared in SCOP 1.73
  
• d2grep2 appears in SCOPe 2.07