Lineage for d2gref1 (2gre F:74-186)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2798607Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies)
    barrel, closed; n=6, S=8; greek-key
    Many cradle-loop superfamilies may be homologous, according to PubMed 18457946
  4. 2799068Superfamily b.49.3: Aminopeptidase/glucanase lid domain [101821] (1 family) (S)
  5. 2799069Family b.49.3.1: Aminopeptidase/glucanase lid domain [101822] (7 proteins)
  6. 2799078Protein Deblocking aminopeptidase YhfE [141387] (1 species)
  7. 2799079Species Bacillus cereus [TaxId:1396] [141388] (1 PDB entry)
    Uniprot Q81HB5 74-186
    BC0901
  8. 2799085Domain d2gref1: 2gre F:74-186 [135538]
    Other proteins in same PDB: d2grea2, d2greb2, d2grec2, d2gred2, d2gree2, d2gref2, d2greg2, d2greh2, d2grei2, d2grej2, d2grek2, d2grel2, d2grem2, d2gren2, d2greo2, d2grep2
    automated match to d2grea1
    complexed with so4

Details for d2gref1

PDB Entry: 2gre (more details), 2.65 Å

PDB Description: Crystal structure of Deblocking aminopeptidase from Bacillus cereus
PDB Compounds: (F:) Deblocking aminopeptidase

SCOPe Domain Sequences for d2gref1:

Sequence, based on SEQRES records: (download)

>d2gref1 b.49.3.1 (F:74-186) Deblocking aminopeptidase YhfE {Bacillus cereus [TaxId: 1396]}
gamvkeikpdgrlslsmiggfrwnsvegeyceietssgktytgtilmhqtsvhvykdage
akrdeknievridervfsadevrelgievgdfvsfdprvqitesgyiksrhld

Sequence, based on observed residues (ATOM records): (download)

>d2gref1 b.49.3.1 (F:74-186) Deblocking aminopeptidase YhfE {Bacillus cereus [TaxId: 1396]}
gamvkeikpdgrlslsmiggfrwnsvegeyceietssgktytgtilmknievridervfs
adevrelgievgdfvsfdprvqitesgyiksrhld

SCOPe Domain Coordinates for d2gref1:

Click to download the PDB-style file with coordinates for d2gref1.
(The format of our PDB-style files is described here.)

Timeline for d2gref1: