SCOPe 2.07: Domain d2go5b1: 2go5 B:14-118

Lineage for d2go5b1 (2go5 B:14-118)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.201: SRP19 [69694] (1 superfamily)
   beta-alpha-beta(2)-alpha; 2 layers: alpha/beta

4. Superfamily d.201.1: SRP19 [69695] (2 families)
   automatically mapped to Pfam PF01922

5. Family d.201.1.1: SRP19 [69696] (1 protein)

6. Protein SRP19 [69697] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69698] (4 PDB entries)

8. Domain d2go5b1: 2go5 B:14-118 [135432]
   Other proteins in same PDB: d2go511, d2go512, d2go521, d2go5w1
   automatically matched to d1jida_
   protein/RNA complex

Details for d2go5b1

PDB Entry: 2go5, 7.4 Å

PDB Description: Structure of signal recognition particle receptor (SR) in complex with signal recognition particle (SRP) and ribosome nascent chain complex

PDB Compounds: (B:) Signal recognition particle 19 kDa protein (SRP19)

SCOPe Domain Sequences for d2go5b1:

Sequence; same for both SEQRES and ATOM records:

>d2go5b1 d.201.1.1 (B:14-118) SRP19 {Human (Homo sapiens) [TaxId: 9606]}
rficiypaylnnkktiaegrripiskavenptateiqdvcsavglnvfleknkmysrewn
rdvqyrgrvrvqlkqedgslclvqfpsrksvmlyaaemipklktr

Timeline for d2go5b1:

• d2go5b1 first appeared in SCOP 1.73
  
• d2go5b1 appears in SCOPe 2.06
  
• d2go5b1 appears in the current release, SCOPe 2.08