Lineage for d2go5b1 (2go5 B:14-118)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 739722Fold d.201: SRP19 [69694] (1 superfamily)
    beta-alpha-beta(2)-alpha; 2 layers: alpha/beta
  4. 739723Superfamily d.201.1: SRP19 [69695] (1 family) (S)
  5. 739724Family d.201.1.1: SRP19 [69696] (1 protein)
  6. 739725Protein SRP19 [69697] (3 species)
  7. 739732Species Human (Homo sapiens) [TaxId:9606] [69698] (4 PDB entries)
  8. 739735Domain d2go5b1: 2go5 B:14-118 [135432]
    Other proteins in same PDB: d2go511, d2go521, d2go5w1
    automatically matched to d1jida_

Details for d2go5b1

PDB Entry: 2go5 (more details), 7.4 Å

PDB Description: Structure of signal recognition particle receptor (SR) in complex with signal recognition particle (SRP) and ribosome nascent chain complex
PDB Compounds: (B:) Signal recognition particle 19 kDa protein (SRP19)

SCOP Domain Sequences for d2go5b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2go5b1 d.201.1.1 (B:14-118) SRP19 {Human (Homo sapiens) [TaxId: 9606]}
rficiypaylnnkktiaegrripiskavenptateiqdvcsavglnvfleknkmysrewn
rdvqyrgrvrvqlkqedgslclvqfpsrksvmlyaaemipklktr

SCOP Domain Coordinates for d2go5b1:

Click to download the PDB-style file with coordinates for d2go5b1.
(The format of our PDB-style files is described here.)

Timeline for d2go5b1: