Lineage for d2gm7b2 (2gm7 B:2-212)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732616Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 2732617Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 2732860Family a.132.1.0: automated matches [191333] (1 protein)
    not a true family
  6. 2732861Protein automated matches [190172] (9 species)
    not a true protein
  7. 2732889Species Pyrobaculum aerophilum [TaxId:178306] [187120] (2 PDB entries)
  8. 2732894Domain d2gm7b2: 2gm7 B:2-212 [135365]
    Other proteins in same PDB: d2gm7a1, d2gm7a2, d2gm7b3, d2gm7c3, d2gm7d3
    automated match to d1udda_
    complexed with gol, pe4, po4

Details for d2gm7b2

PDB Entry: 2gm7 (more details), 2.8 Å

PDB Description: tena homolog/thi-4 thiaminase from pyrobaculum aerophilum
PDB Compounds: (B:) tenA homolog/Thi-4 Thiaminase

SCOPe Domain Sequences for d2gm7b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gm7b2 a.132.1.0 (B:2-212) automated matches {Pyrobaculum aerophilum [TaxId: 178306]}
vtgelrrradgiwqrilahpfvaelyagtlpmekfkyyllqdynylvnfakalslaasra
psvdlmktalelaygtvtgemanyeallkevglslrdaaeaepnrvnvsymaylkstcal
egfyqcmaallpcfwsyaeiaerhggklrenpvhvykkwasvylspeyrglverlravld
ssglsaeelwpyfkeaslyelefwqaayegh

SCOPe Domain Coordinates for d2gm7b2:

Click to download the PDB-style file with coordinates for d2gm7b2.
(The format of our PDB-style files is described here.)

Timeline for d2gm7b2: