Lineage for d2gm7a1 (2gm7 A:2-212)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732616Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 2732617Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 2732777Family a.132.1.3: TENA/THI-4 [101458] (9 proteins)
    Pfam PF03070; HO-related family lacking the heme-binding site
  6. 2732813Protein TenA homolog PAE0170 [140952] (1 species)
  7. 2732814Species Pyrobaculum aerophilum [TaxId:13773] [140953] (1 PDB entry)
    Uniprot Q8ZZM9 2-212
  8. 2732815Domain d2gm7a1: 2gm7 A:2-212 [135364]
    Other proteins in same PDB: d2gm7a2, d2gm7b2, d2gm7b3, d2gm7c2, d2gm7c3, d2gm7d2, d2gm7d3
    complexed with gol, pe4, po4

Details for d2gm7a1

PDB Entry: 2gm7 (more details), 2.8 Å

PDB Description: tena homolog/thi-4 thiaminase from pyrobaculum aerophilum
PDB Compounds: (A:) tenA homolog/Thi-4 Thiaminase

SCOPe Domain Sequences for d2gm7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gm7a1 a.132.1.3 (A:2-212) TenA homolog PAE0170 {Pyrobaculum aerophilum [TaxId: 13773]}
vtgelrrradgiwqrilahpfvaelyagtlpmekfkyyllqdynylvnfakalslaasra
psvdlmktalelaygtvtgemanyeallkevglslrdaaeaepnrvnvsymaylkstcal
egfyqcmaallpcfwsyaeiaerhggklrenpvhvykkwasvylspeyrglverlravld
ssglsaeelwpyfkeaslyelefwqaayegh

SCOPe Domain Coordinates for d2gm7a1:

Click to download the PDB-style file with coordinates for d2gm7a1.
(The format of our PDB-style files is described here.)

Timeline for d2gm7a1: