Lineage for d2gkve_ (2gkv E:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1127558Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1127559Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1127560Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins)
  6. 1127751Protein automated matches [190306] (2 species)
    not a true protein
  7. 1127755Species Streptomyces griseus [TaxId:1911] [187119] (8 PDB entries)
  8. 1127763Domain d2gkve_: 2gkv E: [135335]
    Other proteins in same PDB: d2gkva_, d2gkvb_
    automated match to d1sgde_

Details for d2gkve_

PDB Entry: 2gkv (more details), 1.7 Å

PDB Description: crystal structure of the sgpb:p14'-ala32 omtky3-del(1-5) complex
PDB Compounds: (E:) Streptogrisin B

SCOPe Domain Sequences for d2gkve_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gkve_ b.47.1.1 (E:) automated matches {Streptomyces griseus [TaxId: 1911]}
isggdaiysstgrcslgfnvrsgstyyfltaghctdgattwwansarttvlgttsgssfp
nndygivrytnttipkdgtvggqditsaanatvgmavtrrgsttgthsgsvtalnatvny
gggdvvygmirtnvcaepgdsggplysgtraigltsggsgncssggttffqpvtealsay
gvsvy

SCOPe Domain Coordinates for d2gkve_:

Click to download the PDB-style file with coordinates for d2gkve_.
(The format of our PDB-style files is described here.)

Timeline for d2gkve_: