PDB entry 2gkv

View 2gkv on RCSB PDB site
Description: Crystal structure of the SGPB:P14'-Ala32 OMTKY3-del(1-5) complex
Class: hydrolase/hydrolase inhibitor
Keywords: beta-barrels, catalytic triad, substrate-binding region, reactive-site loop, alpha-helix, beta-sheet, HYDROLASE/HYDROLASE INHIBITOR COMPLEX
Deposited on 2006-04-03, released 2007-02-13
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.215
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ovomucoid
    Species: Meleagris gallopavo [TaxId:9103]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68390 (0-50)
      • engineered (26)
    Domains in SCOPe 2.02: d2gkva_
  • Chain 'B':
    Compound: Ovomucoid
    Species: Meleagris gallopavo [TaxId:9103]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68390 (0-50)
      • engineered (26)
    Domains in SCOPe 2.02: d2gkvb_
  • Chain 'E':
    Compound: Streptogrisin B
    Species: Streptomyces griseus [TaxId:1911]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2gkve_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gkvA (A:)
    vdcseypkpactleyrplcgsdnktyankcnfcnavvesngtltlshfgkc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gkvB (B:)
    vdcseypkpactleyrplcgsdnktyankcnfcnavvesngtltlshfgkc
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gkvE (E:)
    isggdaiysstgrcslgfnvrsgstyyfltaghctdgattwwansarttvlgttsgssfp
    nndygivrytnttipkdgtvggqditsaanatvgmavtrrgsttgthsgsvtalnatvny
    gggdvvygmirtnvcaepgdsggplysgtraigltsggsgncssggttffqpvtealsay
    gvsvy