PDB entry 2gkv
View 2gkv on RCSB PDB site
Description: Crystal structure of the SGPB:P14'-Ala32 OMTKY3-del(1-5) complex
Class: hydrolase/hydrolase inhibitor
Keywords: beta-barrels, catalytic triad, substrate-binding region, reactive-site loop, alpha-helix, beta-sheet, HYDROLASE/HYDROLASE INHIBITOR COMPLEX
Deposited on
2006-04-03, released
2007-02-13
The last revision prior to the SCOPe 2.02 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.215
AEROSPACI score: 0.52
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Ovomucoid
Species: Meleagris gallopavo [TaxId:9103]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d2gkva_ - Chain 'B':
Compound: Ovomucoid
Species: Meleagris gallopavo [TaxId:9103]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d2gkvb_ - Chain 'E':
Compound: Streptogrisin B
Species: Streptomyces griseus [TaxId:1911]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d2gkve_ - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2gkvA (A:)
vdcseypkpactleyrplcgsdnktyankcnfcnavvesngtltlshfgkc
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2gkvB (B:)
vdcseypkpactleyrplcgsdnktyankcnfcnavvesngtltlshfgkc
- Chain 'E':
Sequence; same for both SEQRES and ATOM records: (download)
>2gkvE (E:)
isggdaiysstgrcslgfnvrsgstyyfltaghctdgattwwansarttvlgttsgssfp
nndygivrytnttipkdgtvggqditsaanatvgmavtrrgsttgthsgsvtalnatvny
gggdvvygmirtnvcaepgdsggplysgtraigltsggsgncssggttffqpvtealsay
gvsvy