![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
![]() | Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
![]() | Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins) this domain follows the catalytic beta/alpha barrel domain |
![]() | Protein Bacterial alpha-Amylase [51013] (9 species) |
![]() | Species Bacillus halmapalus [TaxId:79882] [141551] (3 PDB entries) |
![]() | Domain d2gjra1: 2gjr A:399-485 [135285] Other proteins in same PDB: d2gjra2 automatically matched to 1W9X A:399-485 complexed with act, ca, na |
PDB Entry: 2gjr (more details), 2.1 Å
SCOP Domain Sequences for d2gjra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gjra1 b.71.1.1 (A:399-485) Bacterial alpha-Amylase {Bacillus halmapalus [TaxId: 79882]} gtqhdyfdhhniigwtregntthpnsglatimsdgpggekwmyvgqnkagqvwhditgnk pgtvtinadgwanfsvnggsvsiwvkr
Timeline for d2gjra1: