SCOP 1.73: Domain d2gjra1: 2gjr A:399-485

Lineage for d2gjra1 (2gjr A:399-485)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Bacterial alpha-Amylase [51013] (9 species)

7. Species Bacillus halmapalus [TaxId:79882] [141551] (3 PDB entries)

8. Domain d2gjra1: 2gjr A:399-485 [135285]
   Other proteins in same PDB: d2gjra2
   automatically matched to 1W9X A:399-485
   complexed with act, ca, na

Details for d2gjra1

PDB Entry: 2gjr, 2.1 Å

PDB Description: structure of bacillus halmapalus alpha-amylase without any substrate analogues

PDB Compounds: (A:) alpha-amylase

SCOP Domain Sequences for d2gjra1:

Sequence; same for both SEQRES and ATOM records:

>d2gjra1 b.71.1.1 (A:399-485) Bacterial alpha-Amylase {Bacillus halmapalus [TaxId: 79882]}
gtqhdyfdhhniigwtregntthpnsglatimsdgpggekwmyvgqnkagqvwhditgnk
pgtvtinadgwanfsvnggsvsiwvkr

Timeline for d2gjra1:

• d2gjra1 is new in SCOP 1.73
  
• d2gjra1 appears in SCOP 1.75
  
• d2gjra1 appears in the current release, SCOPe 2.08