Lineage for d2gjra1 (2gjr A:396-485)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2400339Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2400340Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2400933Family b.71.1.0: automated matches [227134] (1 protein)
    not a true family
  6. 2400934Protein automated matches [226835] (35 species)
    not a true protein
  7. 2400944Species Bacillus halmapalus [TaxId:79882] [255188] (2 PDB entries)
  8. 2400946Domain d2gjra1: 2gjr A:396-485 [135285]
    Other proteins in same PDB: d2gjra2
    automated match to d1ud2a1
    complexed with act, ca, na

Details for d2gjra1

PDB Entry: 2gjr (more details), 2.1 Å

PDB Description: structure of bacillus halmapalus alpha-amylase without any substrate analogues
PDB Compounds: (A:) alpha-amylase

SCOPe Domain Sequences for d2gjra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gjra1 b.71.1.0 (A:396-485) automated matches {Bacillus halmapalus [TaxId: 79882]}
faygtqhdyfdhhniigwtregntthpnsglatimsdgpggekwmyvgqnkagqvwhdit
gnkpgtvtinadgwanfsvnggsvsiwvkr

SCOPe Domain Coordinates for d2gjra1:

Click to download the PDB-style file with coordinates for d2gjra1.
(The format of our PDB-style files is described here.)

Timeline for d2gjra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gjra2