Lineage for d2gj9d_ (2gj9 D:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 987024Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 987025Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 987698Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 988558Protein automated matches [190047] (13 species)
    not a true protein
  7. 988571Species Escherichia coli [TaxId:469008] [187117] (3 PDB entries)
  8. 988581Domain d2gj9d_: 2gj9 D: [135277]
    automated match to d1rfla_
    complexed with alf, gdp, mg, rb

Details for d2gj9d_

PDB Entry: 2gj9 (more details), 2 Å

PDB Description: Structure of the MnmE G-domain in complex with GDP*AlF4-, Mg2+ and Rb+
PDB Compounds: (D:) tRNA modification GTPase trmE

SCOPe Domain Sequences for d2gj9d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gj9d_ c.37.1.8 (D:) automated matches {Escherichia coli [TaxId: 469008]}
mkvviagrpnagkssllnalagreaaivtdiagttrdvlrehihidgmplhiidtaglre
asdeverigierawqeieqadrvlfmvdgtttdavdpaeiwpefiarlpaklpitvvrnk
aditgetlgmsevnghalirlsartgegvdvlrnhlkqsm

SCOPe Domain Coordinates for d2gj9d_:

Click to download the PDB-style file with coordinates for d2gj9d_.
(The format of our PDB-style files is described here.)

Timeline for d2gj9d_: