![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (78 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein Probable tRNA modification GTPase TrmE (MnmE), G domain [102366] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [102367] (4 PDB entries) |
![]() | Domain d2gj9a1: 2gj9 A:216-376 [135274] automatically matched to d1rfla_ complexed with alf, gdp, mg, rb |
PDB Entry: 2gj9 (more details), 2 Å
SCOP Domain Sequences for d2gj9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gj9a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} gmkvviagrpnagkssllnalagreaaivtdiagttrdvlrehihidgmplhiidtaglr easdeverigierawqeieqadrvlfmvdgtttdavdpaeiwpefiarlpaklpitvvrn kaditgetlgmsevnghalirlsartgegvdvlrnhlkqsm
Timeline for d2gj9a1: