SCOP 1.73: Domain d2gj9c1: 2gj9 C:216-376

Lineage for d2gj9c1 (2gj9 C:216-376)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (78 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Probable tRNA modification GTPase TrmE (MnmE), G domain [102366] (1 species)

7. Species Escherichia coli [TaxId:562] [102367] (4 PDB entries)

8. Domain d2gj9c1: 2gj9 C:216-376 [135276]
   automatically matched to d1rfla_
   complexed with alf, gdp, mg, rb

Details for d2gj9c1

PDB Entry: 2gj9, 2 Å

PDB Description: Structure of the MnmE G-domain in complex with GDP*AlF4-, Mg2+ and Rb+

PDB Compounds: (C:) tRNA modification GTPase trmE

SCOP Domain Sequences for d2gj9c1:

Sequence; same for both SEQRES and ATOM records:

>d2gj9c1 c.37.1.8 (C:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]}
gmkvviagrpnagkssllnalagreaaivtdiagttrdvlrehihidgmplhiidtaglr
easdeverigierawqeieqadrvlfmvdgtttdavdpaeiwpefiarlpaklpitvvrn
kaditgetlgmsevnghalirlsartgegvdvlrnhlkqsm

Timeline for d2gj9c1:

• d2gj9c1 is new in SCOP 1.73
  
• d2gj9c1 appears in SCOP 1.75
  
• d2gj9c1 appears in the current release, SCOPe 2.08, called d2gj9c_