SCOPe 2.08: Domain d2gj6a2: 2gj6 A:1-181

Lineage for d2gj6a2 (2gj6 A:1-181)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)

7. Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (104 PDB entries)
   Uniprot P01892 25-298

8. Domain d2gj6a2: 2gj6 A:1-181 [135258]
   Other proteins in same PDB: d2gj6a1, d2gj6b2, d2gj6b3, d2gj6d1, d2gj6d2, d2gj6e1, d2gj6e2
   automatically matched to d1akja2
   complexed with 3ib, gol, so4

Details for d2gj6a2

PDB Entry: 2gj6, 2.56 Å

PDB Description: the complex between tcr a6 and human class i mhc hla-a2 with the modified htlv-1 tax (y5k-4-[3-indolyl]-butyric acid) peptide

PDB Compounds: (A:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d2gj6a2:

Sequence; same for both SEQRES and ATOM records:

>d2gj6a2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

Timeline for d2gj6a2:

• d2gj6a2 first appeared in SCOP 1.73
  
• d2gj6a2 appears in SCOPe 2.07