SCOPe 2.08: Domain d2gj6d2: 2gj6 D:118-196

Lineage for d2gj6d2 (2gj6 D:118-196)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein T-cell antigen receptor [49125] (7 species)

7. Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [49126] (11 PDB entries)

8. Domain d2gj6d2: 2gj6 D:118-196 [135261]
   Other proteins in same PDB: d2gj6a1, d2gj6a2, d2gj6b2, d2gj6b3, d2gj6d1, d2gj6e1
   automatically matched to d1g6ra2
   complexed with 3ib, gol, so4

Details for d2gj6d2

PDB Entry: 2gj6, 2.56 Å

PDB Description: the complex between tcr a6 and human class i mhc hla-a2 with the modified htlv-1 tax (y5k-4-[3-indolyl]-butyric acid) peptide

PDB Compounds: (D:) A6-Tcr

SCOPe Domain Sequences for d2gj6d2:

Sequence; same for both SEQRES and ATOM records:

>d2gj6d2 b.1.1.2 (D:118-196) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdktvldmrsmdfksns
avawsnksdfacanafnns

Timeline for d2gj6d2:

• d2gj6d2 first appeared in SCOP 1.73
  
• d2gj6d2 appears in SCOPe 2.07