Lineage for d2gj6d2 (2gj6 D:118-196)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749668Protein T-cell antigen receptor [49125] (7 species)
  7. 2749791Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [49126] (11 PDB entries)
  8. 2749796Domain d2gj6d2: 2gj6 D:118-196 [135261]
    Other proteins in same PDB: d2gj6a1, d2gj6a2, d2gj6b2, d2gj6b3, d2gj6d1, d2gj6e1
    automatically matched to d1g6ra2
    complexed with 3ib, gol, so4

Details for d2gj6d2

PDB Entry: 2gj6 (more details), 2.56 Å

PDB Description: the complex between tcr a6 and human class i mhc hla-a2 with the modified htlv-1 tax (y5k-4-[3-indolyl]-butyric acid) peptide
PDB Compounds: (D:) A6-Tcr

SCOPe Domain Sequences for d2gj6d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gj6d2 b.1.1.2 (D:118-196) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdktvldmrsmdfksns
avawsnksdfacanafnns

SCOPe Domain Coordinates for d2gj6d2:

Click to download the PDB-style file with coordinates for d2gj6d2.
(The format of our PDB-style files is described here.)

Timeline for d2gj6d2: