Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species) |
Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (104 PDB entries) Uniprot P01892 25-298 |
Domain d2gitd2: 2git D:1-181 [135250] Other proteins in same PDB: d2gita1, d2gitb2, d2gitb3, d2gitd1, d2gite2, d2gite3 automatically matched to d1akja2 complexed with fmt, gol, na |
PDB Entry: 2git (more details), 1.7 Å
SCOPe Domain Sequences for d2gitd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gitd2 d.19.1.1 (D:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]} gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq r
Timeline for d2gitd2: