Lineage for d2gitd2 (2git D:1-181)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2544619Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2544620Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2544621Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2544723Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2544763Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (103 PDB entries)
    Uniprot P01892 25-298
  8. 2544787Domain d2gitd2: 2git D:1-181 [135250]
    Other proteins in same PDB: d2gita1, d2gitb2, d2gitb3, d2gitd1, d2gite2, d2gite3
    automatically matched to d1akja2
    complexed with fmt, gol, na

Details for d2gitd2

PDB Entry: 2git (more details), 1.7 Å

PDB Description: human class i mhc hla-a2 in complex with the modified htlv-1 tax (y5k-4-[3-indolyl]-butyric acid) peptide
PDB Compounds: (D:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d2gitd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gitd2 d.19.1.1 (D:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

SCOPe Domain Coordinates for d2gitd2:

Click to download the PDB-style file with coordinates for d2gitd2.
(The format of our PDB-style files is described here.)

Timeline for d2gitd2: