SCOP 1.75: Domain d2ghob1: 2gho B:6-49,B:173-228

Lineage for d2ghob1 (2gho B:6-49,B:173-228)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.74: DCoH-like [55247] (5 superfamilies)
   beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta

4. Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (2 families)
   form homo and heterodimers

5. Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (2 proteins)

6. Protein RNA polymerase alpha [55259] (3 species)

7. Species Thermus aquaticus [TaxId:271] [64314] (4 PDB entries)

8. Domain d2ghob1: 2gho B:6-49,B:173-228 [135182]
   Other proteins in same PDB: d2ghoa2, d2ghob2, d2ghoc1, d2ghod1
   automatically matched to d1i6vb1

Details for d2ghob1

PDB Entry: 2gho, 5 Å

PDB Description: recombinant thermus aquaticus rna polymerase for structural studies

PDB Compounds: (B:) DNA-directed RNA polymerase alpha chain

SCOP Domain Sequences for d2ghob1:

Sequence; same for both SEQRES and ATOM records:

>d2ghob1 d.74.3.1 (B:6-49,B:173-228) RNA polymerase alpha {Thermus aquaticus [TaxId: 271]}
lkapvftattqgdhygefvleplergfgvtlgnplrrillssipXpvrrvafqvedtrlg
qrtdldkltlriwtdgsvtplealnqavailkehlnyfanp

Timeline for d2ghob1:

• d2ghob1 first appeared in SCOP 1.73
  
• d2ghob1 appears in SCOPe 2.01
  
• d2ghob1 appears in the current release, SCOPe 2.08