PDB entry 2gho

View 2gho on RCSB PDB site
Description: Recombinant Thermus aquaticus RNA polymerase for Structural Studies
Class: transferase
Keywords: Thermus aquaticus RNA polymerase, recombinant multiprotein complex, coexpression
Deposited on 2006-03-27, released 2006-05-23
The last revision prior to the SCOP 1.75 freeze date was dated 2006-05-23, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 5 Å
R-factor: 0.336
AEROSPACI score: -0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-directed RNA polymerase alpha chain
    Species: Thermus aquaticus
    Gene: rpoA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2ghoa1, d2ghoa2
  • Chain 'B':
    Compound: DNA-directed RNA polymerase alpha chain
    Species: Thermus aquaticus
    Gene: rpoA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2ghob1, d2ghob2
  • Chain 'C':
    Compound: DNA-directed RNA polymerase beta chain
    Species: Thermus aquaticus
    Gene: rpoB
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2ghoc1
  • Chain 'D':
    Compound: DNA-directed RNA polymerase beta' chain
    Species: Thermus aquaticus
    Gene: rpoC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KWU6 (160-End)
      • linker (158-159)
    Domains in SCOP 1.75: d2ghod1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ghoA (A:)
    mlesklkapvftattqgdhygefvleplergfgvtlgnplrrillssipgtavtsvyied
    vlhefstipgvkedvveiilnlkelvvrfldpkmasttlilraegpkevragdftpsadv
    eimnpdlhiatleeggklymevrvdrgvgyvpaerhgikdrinaipvdaifspvrrvafq
    vedtrlgqrtdldkltlriwtdgsvtplealnqavailkehlnyfanpeasllptpevsk
    gekresaeedldlpleelglstrvlhslkeegiesvrallalnlkdlrnipgigerslee
    irqalakkgftlke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ghoA (A:)
    lkapvftattqgdhygefvleplergfgvtlgnplrrillssipgtavtsvyiedvlhef
    stipgvkedvveiilnlkelvvrfldpkmasttlilraegpkevragdftpsadveimnp
    dlhiatleeggklymevrvdrgvgyvpaerhgikdrinaipvdaifspvrrvafqvedtr
    lgqrtdldkltlriwtdgsvtplealnqavailkehlnyfanpeasllpt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ghoB (B:)
    mlesklkapvftattqgdhygefvleplergfgvtlgnplrrillssipgtavtsvyied
    vlhefstipgvkedvveiilnlkelvvrfldpkmasttlilraegpkevragdftpsadv
    eimnpdlhiatleeggklymevrvdrgvgyvpaerhgikdrinaipvdaifspvrrvafq
    vedtrlgqrtdldkltlriwtdgsvtplealnqavailkehlnyfanpeasllptpevsk
    gekresaeedldlpleelglstrvlhslkeegiesvrallalnlkdlrnipgigerslee
    irqalakkgftlke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ghoB (B:)
    sklkapvftattqgdhygefvleplergfgvtlgnplrrillssipgtavtsvyiedvlh
    efstipgvkedvveiilnlkelvvrfldpkmasttlilraegpkevragdftpsadveim
    npdlhiatleeggklymevrvdrgvgyvpaerhgikdrinaipvdaifspvrrvafqved
    trlgqrtdldkltlriwtdgsvtplealnqavailkehlnyfanp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ghoC (C:)
    meikrfgrireviplpplteiqvesykkalqadvppekrenvgiqaafketfpieegdkg
    kgglvldfleyrigdppfsqdecrekdltyqaplyarlqlihkdtglikedevflghlpl
    mtedgsfiingadrvivsqihrspgvyftpdparpgryiasiiplpkrgpwidleveasg
    vvtmkvnkrkfplvlllrvlgydqetlvrelsaygdlvqglldeavlamrpeeamvrlft
    llrpgdppkkdkalaylfglladpkrydlgeagrykaeeklgvglsgrtlvrfedgefkd
    evflptlrylfaltagvpghevddidhlgnrrirtvgelmadqfrvglarlargvrermv
    mgspdtltpaklvnsrpleaalreffsrsqlsqfkdetnplsslrhkrrisalgpggltr
    eragfdvrdvhrthygricpvetpeganiglitslaayarvdalgfirtpyrrvkngvvt
    eevvymtaseedrytiaqantplegdriatdrvvarrrgepvivapeevefmdvspkqvf
    slntnlipflehddanralmgsnmqtqavpliraqapvvmtgleervvrdslaalyaeed
    gevvkvdgtriavryedgrlvehplrryarsnqgtafdqrprvrvgqrvkkgdlladgpa
    seegflalgqnvlvaimpfdgynfedaiviseellkrdfytsihieryeieardtklgpe
    ritrdiphlseaalrdldeegivrigaevkpgdilvgrtsfkgeqepspeerllrsifge
    kardvkdtslrvppgeggivvgrlrlrrgdpgvelkpgvrevvrvfvaqkrklqvgdkla
    nrhgnkgvvakilpvedmphlpdgtpvdvilnplgvpsrmnlgqilethlglagyflgqr
    yispvfdgatepeikellaeafnlyfgkrqgegfgvdkrekevlaraeklglvspgkspe
    eqlkelfdlgkvvlydgrtgepfegpivvgqmfimklyhmvedkmharstgpyslitqqp
    lggkaqfggqrfgemevwaleaygaahtlqemltiksddiegrnaayqaiikgedvpeps
    vpesfrvlvkelqalaldvqtldekdnpvdifeglaskr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ghoC (C:)
    meikrfgrireviplpplteiqvesykkalqadvppekrenvgiqaafketfpieegdkg
    kgglvldfleyrigdppfsqdecrekdltyqaplyarlqlihkdtglikedevflghlpl
    mtedgsfiingadrvivsqihrspgvyftpdparpgryiasiiplpkrgpwidleveasg
    vvtmkvnkrkfplvlllrvlgydqetlvrelsaygdlvqglldeavlamrpeeamvrlft
    llrpgdppkkdkalaylfglladpkrydlgeagrykaeeklgvglsgrtlvrfedgefkd
    evflptlrylfaltagvpghevddidhlgnrrirtvgelmadqfrvglarlargvrermv
    mgspdtltpaklvnsrpleaalreffsrsqlsqfkdetnplsslrhkrrisalgpggltr
    eragfdvrdvhrthygricpvetpeganiglitslaayarvdalgfirtpyrrvkngvvt
    eevvymtaseedrytiaqantplegdriatdrvvarrrgepvivapeevefmdvspkqvf
    slntnlipflehddanralmgsnmqtqavpliraqapvvmtgleervvrdslaalyaeed
    gevvkvdgtriavryedgrlvehplrryarsnqgtafdqrprvrvgqrvkkgdlladgpa
    seegflalgqnvlvaimpfdgynfedaiviseellkrdfytsihieryeieardtklgpe
    ritrdiphlseaalrdldeegivrigaevkpgdilvgrtsfkgeqepspeerllrsifge
    kardvkdtslrvppgeggivvgrlrlrrgdpgvelkpgvrevvrvfvaqkrklqvgdkla
    nrhgnkgvvakilpvedmphlpdgtpvdvilnplgvpsrmnlgqilethlglagyflgqr
    yispvfdgatepeikellaeafnlyfgkrqgegfgvdkrekevlaraeklglvspgkspe
    eqlkelfdlgkvvlydgrtgepfegpivvgqmfimklyhmvedkmharstgpyslitqqp
    lggkaqfggqrfgemevwaleaygaahtlqemltiksddiegrnaayqaiikgedvpeps
    vpesfrvlvkelqalaldvqtldekdnpvdifeg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ghoD (D:)
    mkkevrkvrialaspekirswsygevekpetinyrtlkperdglfderifgpikdyecac
    gkykrqrfegkvcercgvevtrsivrryrmghielatpaahiwfvkdvpskigtlldlsa
    teleqvlyfnkyivldpkgavldgvpvekrqlltdeeyggidarmgaeaiqellkeldle
    klerelleemkhpsrarrakarkrlevvrafldsgnrpewmileavpvlppdlrpmvqvd
    ggrfatsdlndlyrrlinrnnrlkkllaqgapeiiirnekrmlqeavdavidngrrgspv
    tnpgserplrsltdilsgkqgrfrqnllgkrvdysgrsvivvgpqlklhqcglpkrmale
    lfkpfllkkmeekafapnvkaarrmlerqrdikdevwdaleevihgkvvllnraptlhrl
    giqafqpvlvegqsiqlhplvceafnadfdgdqmavhvplssfaqaeariqmlsahnlls
    pasgeplakpsrdiilglyyitqvrkekkgagmafatpeealaayergevalnapivvag
    retsvgrlkfvfanpdeallavahglldlqdvvtvrylgrrletspgrilfarivgeavg
    dekvaqeliqmdvpqeknslkdlvyqaflrlgmektarlldalkyygftlsttsgitigi
    ddavipeekqryleeadrklrqieqayemgfltdrerydqviqlwtettekvtqavfknf
    eenypfnplyvmaqsgargnpqqirqlcgmrglmqkpsgetfevpvrssfregltvleyf
    isshgarkggadtalrtadsgyltrklvdvaheivvreadcgttnyisvplfqmdevtrt
    lrlrkrsdiesglygrvlarevealgrrleegrylsledvhflikaaeagevrevpvrsp
    ltcqtrygvcqkcygydlsmarpvsigeavgvvaaesigepgtqltmrtfhtggvavgtd
    itqglprvielfearrpkakaviseidgvvrieegedrlsvfvesegfskeyklpkdarl
    lvkdgdyveagqpltrgaidphqlleakgpeaverylvdeiqkvyraqgvklhdkhieiv
    vrqmlkyvevtdpgdsrllegqvlekwdvealnerliaegkvpvawkpllmgvtksalst
    kswlsaasfqntthvlteaaiagkkdeliglkenvilgrlipagtgsdfvrftqvvdqrt
    lkaieearkeaveakekeaprrpvrreqpgkgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ghoD (D:)
    kevrkvrialaspekirswsygevekpetinyrtlkperdglfderifgpikdyecacgk
    ykrqrfegkvcercgvevtrsivrryrmghielatpaahiwfvkdvpskigtlldlsate
    leqvlyfnkyivldpkgavldgvpvekrqlltdeeyggidarmgaeaiqellkeldlekl
    erelleemkhpsrarrakarkrlevvrafldsgnrpewmileavpvlppdlrpmvqvdgg
    rfatsdlndlyrrlinrnnrlkkllaqgapeiiirnekrmlqeavdavidngrrgspvtn
    pgserplrsltdilsgkqgrfrqnllgkrvdysgrsvivvgpqlklhqcglpkrmalelf
    kpfllkkmeekafapnvkaarrmlerqrdikdevwdaleevihgkvvllnraptlhrlgi
    qafqpvlvegqsiqlhplvceafnadfdgdqmavhvplssfaqaeariqmlsahnllspa
    sgeplakpsrdiilglyyitqvrkekkgagmafatpeealaayergevalnapivvagre
    tsvgrlkfvfanpdeallavahglldlqdvvtvrylgrrletspgrilfarivgeavgde
    kvaqeliqmdvpqeknslkdlvyqaflrlgmektarlldalkyygftlsttsgitigidd
    avipeekqryleeadrklrqieqayemgfltdrerydqviqlwtettekvtqavfknfee
    nypfnplyvmaqsgargnpqqirqlcgmrglmqkpsgetfevpvrssfregltvleyfis
    shgarkggadtalrtadsgyltrklvdvaheivvreadcgttnyisvplfqmdevtrtlr
    lrkrsdiesglygrvlarevealgrrleegrylsledvhflikaaeagevrevpvrsplt
    cqtrygvcqkcygydlsmarpvsigeavgvvaaesigepgtqltmrttqglprvielfea
    rrpkakaviseidgvvrieegedrlsvfvesegfskeyklpkdarllvkdgdyveagqpl
    trgaidphqlleakgpeaverylvdeiqkvyraqgvklhdkhieivvrqmlkyvevtdpg
    dsrllegqvlekwdvealnerliaegkvpvawkpllmgvtksalstkswlsaasfqntth
    vlteaaiagkkdeliglkenvilgrlipagtgsdfvrftqvvdqrtlkaieearke